PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.18G021500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 468aa    MW: 52589.8 Da    PI: 6.5121
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.18G021500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093894261954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +e+  LA++++Lt++qV++WF N R +
  Manes.18G021500.1.p 389 FEHflHPYPNDSEKLMLASQTSLTKNQVSNWFINARVR 426
                          664459******************************88 PP

2BELL102.33.4e-33251322172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +r+elq k +kL+ ll+e++ rY++y++q+++vissFe++ag g+a++Yt+ Al+a+SrhF +L+dai +qi
  Manes.18G021500.1.p 251 DRHELQVKFTKLVALLDEIEGRYEKYYHQMEQVISSFEEIAGFGTAQSYTAQALQAMSRHFCNLRDAILSQI 322
                          689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-29182320IPR006563POX domain
PfamPF075261.2E-36188318IPR006563POX domain
PROSITE profilePS5007111.791367430IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.6E-27369442IPR009057Homeodomain-like
SMARTSM003891.7E-8370434IPR001356Homeobox domain
CDDcd000866.57E-10370431No hitNo description
SuperFamilySSF466895.13E-17376437IPR009057Homeodomain-like
PfamPF059202.3E-16387426IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MVSHDSPQNL ASSMVQQFFI SGFVTSQNQF ENQNFNGYGS DLRDGNTFPQ SLGLMPSTHS  60
HGERMSRSID LVQAPSMEQD SEVSHTRHLM DLLGAANATN HQPQGLSLSL GPHMLASQVQ  120
YRQRSTNSDF VSPSYLFPEE YARKDCNPGF EQVNNHYSYT CNAFASSSTV QSRSSSTSYG  180
TESFSVAIKK SRYLKPAQVL LEETVSVNAK AAGINNEKLV GNLFSSRRRG ALGLCSELKA  240
ELCCNGFIPA DRHELQVKFT KLVALLDEIE GRYEKYYHQM EQVISSFEEI AGFGTAQSYT  300
AQALQAMSRH FCNLRDAILS QIKATRRTLS QDLPKISKGL SRLSLFDKET GHNRMSLQQL  360
GMIQSQRQAW RPIRGLPETS VTILRSWLFE HFLHPYPNDS EKLMLASQTS LTKNQVSNWF  420
INARVRLWKP MIEEMYKEEF ADSAEESNPF LDSSSMARDD VADDSED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15376434563Homeobox protein Meis2
3k2a_B1e-15376434563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071939.10.0PREDICTED: BEL1-like homeodomain protein 11
SwissprotQ1PFD11e-106BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLA0A067KQR40.0A0A067KQR4_JATCU; Uncharacterized protein
STRINGPOPTR_0002s03230.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126452329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-107BEL1-like homeodomain 11